(data stored in ACNUC7421 zone)

EMBL: CP001700.PE532

CP001700.PE532       Location/Qualifiers
FT   CDS             634396..635424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0549"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="KEGG: msm:MSMEG_1852 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69487"
FT                   /db_xref="GOA:C7PXD6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD6"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACU69487.1"
FT                   /translation="MSVDVEQPSGEVTRRLTQYAHGGGCACKIPPGELESVVAQLAAAE
FT                   PAKSPYELLVGLETGDDAAVVRLTGDTAIISTADFFTPVVDDAYDWGRIAATNALSDVY
FT                   AMGGTPVTAVNLLSWPRDVLPLELVAEVLRGCLDVTRAAGCHLAGGHSVDDPEPKYGMA
FT                   VTGVADARRLLRNDAATPGLPLTLTKPLGIGVLNSRHKATGEVFPQAVDAMTTLNADAA
FT                   TAALAAGATCATDVTGFGLLGHLYKLVRASGVTAVIDPGAVPYLEGARRAALDGFVSGG
FT                   TRRNLAWVNEHVAWGSGVDEVERLLLADAQTSGGLLIVGEVPGFPVIGELVLAGPRSLV
FT                   IG"
     MSVDVEQPSG EVTRRLTQYA HGGGCACKIP PGELESVVAQ LAAAEPAKSP YELLVGLETG        60
     DDAAVVRLTG DTAIISTADF FTPVVDDAYD WGRIAATNAL SDVYAMGGTP VTAVNLLSWP       120
     RDVLPLELVA EVLRGCLDVT RAAGCHLAGG HSVDDPEPKY GMAVTGVADA RRLLRNDAAT       180
     PGLPLTLTKP LGIGVLNSRH KATGEVFPQA VDAMTTLNAD AATAALAAGA TCATDVTGFG       240
     LLGHLYKLVR ASGVTAVIDP GAVPYLEGAR RAALDGFVSG GTRRNLAWVN EHVAWGSGVD       300
     EVERLLLADA QTSGGLLIVG EVPGFPVIGE LVLAGPRSLV IG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page