(data stored in ACNUC7421 zone)

EMBL: CP001700.PE533

CP001700.PE533       Location/Qualifiers
FT   CDS             635461..636594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0550"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dac:Daci_4506
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69488"
FT                   /db_xref="GOA:C7PXD7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69488.1"
FT                   /translation="MMFDRELLDTIVNEVVAPAAAEVDTNAAFPREGVDALARAGVLGL
FT                   TVPKQFGGAGEGLRSAVNVIRTLSSACGSTAMVVAMHYSGTAVLASQERADVLQDIGDG
FT                   RHLTTLAFSEVGSRSHFWAPLSTAKADGDDVLLDARKSWVTSASQADSYVWSSRPMAAD
FT                   GPMSLWFVPSDTPGLSIPRAFDGMGLRGNDSSPVTADGVRVSQTSLLGDDGKGFDLAMA
FT                   AALPVFLVLNAAAGIGLMDALLAEAVKHLSATRLDHLNQSLAQQSPARLTLARMRIEAD
FT                   RTRCLLDETLSALEQERPDAQLFLLEVKAATDESAALVADLAMKVCGGAAFRKELGIER
FT                   RFRDSRAARVMAPTTDVLEDFVGRALCGLPLFDGPAA"
     MMFDRELLDT IVNEVVAPAA AEVDTNAAFP REGVDALARA GVLGLTVPKQ FGGAGEGLRS        60
     AVNVIRTLSS ACGSTAMVVA MHYSGTAVLA SQERADVLQD IGDGRHLTTL AFSEVGSRSH       120
     FWAPLSTAKA DGDDVLLDAR KSWVTSASQA DSYVWSSRPM AADGPMSLWF VPSDTPGLSI       180
     PRAFDGMGLR GNDSSPVTAD GVRVSQTSLL GDDGKGFDLA MAAALPVFLV LNAAAGIGLM       240
     DALLAEAVKH LSATRLDHLN QSLAQQSPAR LTLARMRIEA DRTRCLLDET LSALEQERPD       300
     AQLFLLEVKA ATDESAALVA DLAMKVCGGA AFRKELGIER RFRDSRAARV MAPTTDVLED       360
     FVGRALCGLP LFDGPAA                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page