(data stored in ACNUC7421 zone)

EMBL: CP001700.PE534

CP001700.PE534       Location/Qualifiers
FT   CDS             636591..637448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69489"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD8"
FT                   /inference="similar to AA sequence:KEGG:Daci_4507"
FT                   /protein_id="ACU69489.1"
FT                   /translation="MSNRVLLGAVAYDSKVVTIWDGFRQWFRDRDLDFDYVLYSHYERQ
FT                   IEDLVEGHIDVAWHSPLAWVRTVRLARARSVGVRAVVMRDSDRDLVSAVLVRADSDLAS
FT                   LDDLRGRSVATGAIDSPQAHLLPLSMLREAGLRPDVDFKVSRFDVRVGLHGDHVGGERD
FT                   AAVALRSGLVDAACMLDANTLLFSREGTLPAGSVRVLAKTEPFDHCTMAVGPGADKSTV
FT                   DRFTALLLGMAYDDPTVRPLFDLEGLKQWLPARTDRYSALERAVDELGFLDAEGKLCAD
FT                   DYRP"
     MSNRVLLGAV AYDSKVVTIW DGFRQWFRDR DLDFDYVLYS HYERQIEDLV EGHIDVAWHS        60
     PLAWVRTVRL ARARSVGVRA VVMRDSDRDL VSAVLVRADS DLASLDDLRG RSVATGAIDS       120
     PQAHLLPLSM LREAGLRPDV DFKVSRFDVR VGLHGDHVGG ERDAAVALRS GLVDAACMLD       180
     ANTLLFSREG TLPAGSVRVL AKTEPFDHCT MAVGPGADKS TVDRFTALLL GMAYDDPTVR       240
     PLFDLEGLKQ WLPARTDRYS ALERAVDELG FLDAEGKLCA DDYRP                       285
//

If you have problems or comments...

PBIL Back to PBIL home page