(data stored in ACNUC7421 zone)

EMBL: CP001700.PE535

CP001700.PE535       Location/Qualifiers
FT   CDS             637426..638598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69490"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD9"
FT                   /inference="similar to AA sequence:KEGG:Daci_4508"
FT                   /protein_id="ACU69490.1"
FT                   /translation="MLTIIDLEGLGLDAGAHLVLNRALTGLPAGGRLAVVGGNQMLGVQ
FT                   LGAWCRSEGHGFDPADPPVVIKGTADDARARATQRAGSPSHVDERADAAWGLAARGALV
FT                   EPGGPLLSVDWVDRDLVWADVAPRLYSRAAAEQWDPATAIDWASHADVPDEVEDAVVQI
FT                   MTYLIENEQAALMLPARLLARLHPHFREVMQLFAVQIADEARHVEVFTRRALLSRDELG
FT                   VSGAGGRASLQTLLDEPDFTLASFLLSVLGEGSFLDLLRFLNVHAPDPITATMTSLVGR
FT                   DEARHVAFGVAHTAHAAKADARFLGRLRMAVERRHTALIDTAGLNKQVFDALVVLAAGS
FT                   WETSAIAKGWRAVEELQKRMEDGRRHRLSLIGFPDDEAAELAALHTRNFM"
     MLTIIDLEGL GLDAGAHLVL NRALTGLPAG GRLAVVGGNQ MLGVQLGAWC RSEGHGFDPA        60
     DPPVVIKGTA DDARARATQR AGSPSHVDER ADAAWGLAAR GALVEPGGPL LSVDWVDRDL       120
     VWADVAPRLY SRAAAEQWDP ATAIDWASHA DVPDEVEDAV VQIMTYLIEN EQAALMLPAR       180
     LLARLHPHFR EVMQLFAVQI ADEARHVEVF TRRALLSRDE LGVSGAGGRA SLQTLLDEPD       240
     FTLASFLLSV LGEGSFLDLL RFLNVHAPDP ITATMTSLVG RDEARHVAFG VAHTAHAAKA       300
     DARFLGRLRM AVERRHTALI DTAGLNKQVF DALVVLAAGS WETSAIAKGW RAVEELQKRM       360
     EDGRRHRLSL IGFPDDEAAE LAALHTRNFM                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page