(data stored in ACNUC7421 zone)

EMBL: CP001700.PE536

CP001700.PE536       Location/Qualifiers
FT   CDS             638631..638957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0553"
FT                   /product="selenocysteine synthase"
FT                   /note="KEGG: kra:Krad_1608 selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69491"
FT                   /db_xref="GOA:C7PXE0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE0"
FT                   /inference="similar to AA sequence:KEGG:Krad_1608"
FT                   /protein_id="ACU69491.1"
FT                   /translation="MSDVRRDIPRTDVVLADPRLAAARARLGVDAVKAAVRGAQQKARD
FT                   GEIAAEAVVEVAVASLPSSATTLRPILNATGVVLHTNLGRAPLAPAAVEACDGQKLGHQ
FT                   ADLG"
     MSDVRRDIPR TDVVLADPRL AAARARLGVD AVKAAVRGAQ QKARDGEIAA EAVVEVAVAS        60
     LPSSATTLRP ILNATGVVLH TNLGRAPLAP AAVEACDGQK LGHQADLG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page