(data stored in ACNUC7421 zone)

EMBL: CP001700.PE537

CP001700.PE537       Location/Qualifiers
FT   CDS             638979..640052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0554"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_0474 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69492"
FT                   /db_xref="GOA:C7PXE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69492.1"
FT                   /translation="MAVGLLYRIFVSVLSWLALLARSQASKNAEILVLRQEVSVLRRTN
FT                   PKSRISWTARAVLAALSKLLPKTLRGHRIVTPGTLLRWHRRLVANKWRQPKAPGRPPIS
FT                   DGLVQLIVTMAQENRTWGAVRIQGELRRLGHRVAAATIRKVLRARRIPPPKHRDDSWRT
FT                   FLRTQADTLLATDFFHIDCAVTLARVYVAFVIEYSTRRVHLLGITRYPTAAWAIQLARD
FT                   FTADLETTGRRFTHLVRDRDAKFTAAFDAVLSAAGITAVTTMPQTPKMNAIAERFVGTV
FT                   RRDCTDRILVAGERHLRVILNGYIAHYNAGRSHQGAGMSLRAPDDDPNVIPFPAQIDQI
FT                   RRKRILGGLINEYEPAA"
     MAVGLLYRIF VSVLSWLALL ARSQASKNAE ILVLRQEVSV LRRTNPKSRI SWTARAVLAA        60
     LSKLLPKTLR GHRIVTPGTL LRWHRRLVAN KWRQPKAPGR PPISDGLVQL IVTMAQENRT       120
     WGAVRIQGEL RRLGHRVAAA TIRKVLRARR IPPPKHRDDS WRTFLRTQAD TLLATDFFHI       180
     DCAVTLARVY VAFVIEYSTR RVHLLGITRY PTAAWAIQLA RDFTADLETT GRRFTHLVRD       240
     RDAKFTAAFD AVLSAAGITA VTTMPQTPKM NAIAERFVGT VRRDCTDRIL VAGERHLRVI       300
     LNGYIAHYNA GRSHQGAGMS LRAPDDDPNV IPFPAQIDQI RRKRILGGLI NEYEPAA          357
//

If you have problems or comments...

PBIL Back to PBIL home page