(data stored in ACNUC7421 zone)

EMBL: CP001700.PE538

CP001700.PE538       Location/Qualifiers
FT   CDS             640461..640973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69493.1"
FT                   /translation="MADDHLISEDETRRIAEAFVAGASWLGKPAWGKTGTGLLGAWHAP
FT                   GWYPEDEERDFGGQEGSWSWAVKTVDPSGQKQVLSHEKVLEGVRGLVFGETDDPLDQLA
FT                   IRKLKQWFTEPAAERHKLTLDDALSSRVCQQALFGRKVFPVGDEVSWSDKKPDWFEDQR
FT                   PTAEDAS"
     MADDHLISED ETRRIAEAFV AGASWLGKPA WGKTGTGLLG AWHAPGWYPE DEERDFGGQE        60
     GSWSWAVKTV DPSGQKQVLS HEKVLEGVRG LVFGETDDPL DQLAIRKLKQ WFTEPAAERH       120
     KLTLDDALSS RVCQQALFGR KVFPVGDEVS WSDKKPDWFE DQRPTAEDAS                  170
//

If you have problems or comments...

PBIL Back to PBIL home page