(data stored in ACNUC7421 zone)

EMBL: CP001700.PE539

CP001700.PE539       Location/Qualifiers
FT   CDS             641502..642491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0557"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase catalytic region;
FT                   glutamine synthetase beta-Grasp; KEGG: sgr:SGR_5302
FT                   putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69494"
FT                   /db_xref="GOA:C7PXE3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE3"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ACU69494.1"
FT                   /translation="MGVPTAGLRAKTRVLADGAVPGVWGFDGSSTGQAEGRSSDRVLRP
FT                   VFTCADPVRGGDAVLVLCEVENIDFSPHSSNTRAEARGVAERFAEQEAWFGIEQEYTLF
FT                   RGGRPLGFPEGGGFPAPQGPYYCGVGGGAVFGRELVERHLDYCLAAGLTIAGINAEVMP
FT                   GQWEFQVGPAGPVEVADHMWVARYLLLRVAEEFGVSVSFDAKPEKGDWNGAGAHTNFST
FT                   KAMRESYDPIITACEALGEGDKPAEHVRAYGSGIEDRLTGQHETAPWSEYSYGVSNRGA
FT                   SVRIPWQVEVDKKGYIEDRRPNANVDPYVVTRLIVDTCCSALEKAGQV"
     MGVPTAGLRA KTRVLADGAV PGVWGFDGSS TGQAEGRSSD RVLRPVFTCA DPVRGGDAVL        60
     VLCEVENIDF SPHSSNTRAE ARGVAERFAE QEAWFGIEQE YTLFRGGRPL GFPEGGGFPA       120
     PQGPYYCGVG GGAVFGRELV ERHLDYCLAA GLTIAGINAE VMPGQWEFQV GPAGPVEVAD       180
     HMWVARYLLL RVAEEFGVSV SFDAKPEKGD WNGAGAHTNF STKAMRESYD PIITACEALG       240
     EGDKPAEHVR AYGSGIEDRL TGQHETAPWS EYSYGVSNRG ASVRIPWQVE VDKKGYIEDR       300
     RPNANVDPYV VTRLIVDTCC SALEKAGQV                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page