(data stored in ACNUC7421 zone)

EMBL: CP001700.PE54

CP001700.PE54        Location/Qualifiers
FT   CDS             55176..56021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0054"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_4604 morphological
FT                   differentiation- associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69009"
FT                   /db_xref="GOA:C7QFS0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS0"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU69009.1"
FT                   /translation="MDEHADARADGAGRPAAFFDLDKTIIAKSSTLAFGRSFYNGGLIN
FT                   RRTVLRTAYAQFVYLAGGADHDQMERMRQFLSAMATGWDVEQVKEIVAETLHDLIDPLI
FT                   YSEAAALIAEHKAAGRDVVIVSTSGSEVVEPIAEMLGADLAIGTRMAVGEDGKYSGEIE
FT                   FYAYAENKAKAIVELAAERGYDLTRSFAYSDSATDVPMLESVGHPYAVNPDRTLRKEAT
FT                   AREWPILVFDKPVALRSRVGELAAKPAVSGTALGLALATAGTIWWLGTRGRRRRGSGLL
FT                   "
     MDEHADARAD GAGRPAAFFD LDKTIIAKSS TLAFGRSFYN GGLINRRTVL RTAYAQFVYL        60
     AGGADHDQME RMRQFLSAMA TGWDVEQVKE IVAETLHDLI DPLIYSEAAA LIAEHKAAGR       120
     DVVIVSTSGS EVVEPIAEML GADLAIGTRM AVGEDGKYSG EIEFYAYAEN KAKAIVELAA       180
     ERGYDLTRSF AYSDSATDVP MLESVGHPYA VNPDRTLRKE ATAREWPILV FDKPVALRSR       240
     VGELAAKPAV SGTALGLALA TAGTIWWLGT RGRRRRGSGL L                           281
//

If you have problems or comments...

PBIL Back to PBIL home page