(data stored in ACNUC7421 zone)

EMBL: CP001700.PE540

CP001700.PE540       Location/Qualifiers
FT   CDS             642722..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69495"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE4"
FT                   /inference="similar to AA sequence:KEGG:SCO6025"
FT                   /protein_id="ACU69495.1"
FT                   /translation="MPNLSRRELGLLGMGALALGAFGADHAVTAAEADLVAYPARLAGR
FT                   VAFLHVVAHPDDDLYFLNPDIADSVRTGGEVTTVVLTSAEAGGGASFAAARQHGLRSAY
FT                   ARMAGAEDDAPWRRSVLVTRGGEAELCELEADARVRLVFLDISMGSYTGSTPEDENHTP
FT                   LAALFQGTLTTRPVLQPSETSITAGVYTRDQLVGTLTDLMDHFLPTVVRTMDPDPERRG
FT                   IGPKERAWLTDSGVHTDNEDHTAAAWFTYAAYADHRARRGPSAVRLDSYVGYGNARWRH
FT                   NLGGSSAREKLRLLGVYGWADRRKCGDPVGCGDRTVGGDAARPGWSQSTNLRHVGTTDW
FT                   LRTGPDGRLRAFAVVGGHAVVWSETAPGSGKFSPGKAVNADQSTVSSLTPHLAVSVGLD
FT                   RRAQLVGLRAATDPDRGTWTQEVVVSGERPDGSFTPWTALGAPTGAQTKDAHAVGCPTA
FT                   IVDGRGMLHVFVRNADMTVSWRRRDLVTPGATWTDWRDIGGRRVRDGLTTALTPEGDIE
FT                   LHAVGRTLWTWRIGAGATGEPQRTHSALPPMGDPPTVHALQGGGALLAARAADTGVLTV
FT                   LSRPSGGAWRPCAGKLGGQGGFGVVAIQPHGGGVFLAQRGRRGVVEVVWQAQVGTAGGV
FT                   RRWLGGPGPILRPSLTVDAHGRVVAAAIGPEGALYTARINAGDVPRTLTWQSTALA"
     MPNLSRRELG LLGMGALALG AFGADHAVTA AEADLVAYPA RLAGRVAFLH VVAHPDDDLY        60
     FLNPDIADSV RTGGEVTTVV LTSAEAGGGA SFAAARQHGL RSAYARMAGA EDDAPWRRSV       120
     LVTRGGEAEL CELEADARVR LVFLDISMGS YTGSTPEDEN HTPLAALFQG TLTTRPVLQP       180
     SETSITAGVY TRDQLVGTLT DLMDHFLPTV VRTMDPDPER RGIGPKERAW LTDSGVHTDN       240
     EDHTAAAWFT YAAYADHRAR RGPSAVRLDS YVGYGNARWR HNLGGSSARE KLRLLGVYGW       300
     ADRRKCGDPV GCGDRTVGGD AARPGWSQST NLRHVGTTDW LRTGPDGRLR AFAVVGGHAV       360
     VWSETAPGSG KFSPGKAVNA DQSTVSSLTP HLAVSVGLDR RAQLVGLRAA TDPDRGTWTQ       420
     EVVVSGERPD GSFTPWTALG APTGAQTKDA HAVGCPTAIV DGRGMLHVFV RNADMTVSWR       480
     RRDLVTPGAT WTDWRDIGGR RVRDGLTTAL TPEGDIELHA VGRTLWTWRI GAGATGEPQR       540
     THSALPPMGD PPTVHALQGG GALLAARAAD TGVLTVLSRP SGGAWRPCAG KLGGQGGFGV       600
     VAIQPHGGGV FLAQRGRRGV VEVVWQAQVG TAGGVRRWLG GPGPILRPSL TVDAHGRVVA       660
     AAIGPEGALY TARINAGDVP RTLTWQSTAL A                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page