(data stored in ACNUC7421 zone)

EMBL: CP001700.PE541

CP001700.PE541       Location/Qualifiers
FT   CDS             complement(644814..645221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0559"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ava:Ava_0978
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69496"
FT                   /db_xref="GOA:C7PXE5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69496.1"
FT                   /translation="MDALHPRLLVTRFAEMFGFYEAVLPEMLGAKLMKGSAGGPYANWD
FT                   VEDQAVLILFDRAAMAALAGTRDLPASAAPAQDHTMFVCRVEDVDAGAELCVRHGATLV
FT                   VGPTDRPEWGPTMRTAHVRDPEGNLIELQSY"
     MDALHPRLLV TRFAEMFGFY EAVLPEMLGA KLMKGSAGGP YANWDVEDQA VLILFDRAAM        60
     AALAGTRDLP ASAAPAQDHT MFVCRVEDVD AGAELCVRHG ATLVVGPTDR PEWGPTMRTA       120
     HVRDPEGNLI ELQSY                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page