(data stored in ACNUC7421 zone)

EMBL: CP001700.PE542

CP001700.PE542       Location/Qualifiers
FT   CDS             645280..645768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0560"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: fre:Franean1_3989 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69497"
FT                   /db_xref="GOA:C7PXE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69497.1"
FT                   /translation="MDDLQTAPPSLTSLTTYLLSRTGKIARGRLAERFSERGLRLWHHA
FT                   VLAALADFGPHVQRDLAARLAIDPSDMAKIIDELAGRGTVERARDAADRRRITVTLTDA
FT                   GRTLLAELDAEADVVQSEVLEPLTKDEREQLHALLGKVFEENNSRRAVDSARPVRRQG"
     MDDLQTAPPS LTSLTTYLLS RTGKIARGRL AERFSERGLR LWHHAVLAAL ADFGPHVQRD        60
     LAARLAIDPS DMAKIIDELA GRGTVERARD AADRRRITVT LTDAGRTLLA ELDAEADVVQ       120
     SEVLEPLTKD EREQLHALLG KVFEENNSRR AVDSARPVRR QG                          162
//

If you have problems or comments...

PBIL Back to PBIL home page