(data stored in ACNUC7421 zone)

EMBL: CP001700.PE543

CP001700.PE543       Location/Qualifiers
FT   CDS             645797..646144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0561"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: kra:Krad_2755 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69498"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE7"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACU69498.1"
FT                   /translation="MAQYAILLFDTAGAGDYTPEQQQASQRHAEDLIESGVLSSAYALD
FT                   SVETATSVRGDAVTDGPFIDAKEVVAGFYVVEAPDLDAALELAKRNPAVQWGRGGIEVR
FT                   PVVGSLPPSTR"
     MAQYAILLFD TAGAGDYTPE QQQASQRHAE DLIESGVLSS AYALDSVETA TSVRGDAVTD        60
     GPFIDAKEVV AGFYVVEAPD LDAALELAKR NPAVQWGRGG IEVRPVVGSL PPSTR            115
//

If you have problems or comments...

PBIL Back to PBIL home page