(data stored in ACNUC7421 zone)

EMBL: CP001700.PE544

CP001700.PE544       Location/Qualifiers
FT   CDS             646141..647436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0562"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: saq:Sare_0956 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69499"
FT                   /db_xref="GOA:C7PXE8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXE8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69499.1"
FT                   /translation="MTDADDVARAVADAHRREWAFVLAATVRVAQDFDLAEECVQEAYA
FT                   AALSAWRRDGVPAKPAAWLTTTAKRRAMDAIRRERTLRSKLPLLIELEGREGQEDQEAR
FT                   EGQQHHQDQADPEATVPDERLRLIFTCCHPALAQEAQLALTLRLVCGLSTPDTARMLLV
FT                   SESTMAARITRAKKKISAARIPFRVPRAAELPDRLGAVLGVVHLLFTAGHTAPSGPDLL
FT                   RTELTDRALFLARTLRDLMPDEPEVRGLLALFLVTDTRRATRTDADGRLLRLEEQDRSQ
FT                   WDGEALAEAHELIVAGLRGGRAGRYLLQAAIASLYAQAPTYEETDWSQLVVLYDRLLAV
FT                   WPSPTVALNRTVPLSMAQGPEKAFDAVAELEKDDRLARYPYLPAIKADLWRRLGRDAEA
FT                   TKAYRQALELTDNEAERAFLAGRAGETGPPVR"
     MTDADDVARA VADAHRREWA FVLAATVRVA QDFDLAEECV QEAYAAALSA WRRDGVPAKP        60
     AAWLTTTAKR RAMDAIRRER TLRSKLPLLI ELEGREGQED QEAREGQQHH QDQADPEATV       120
     PDERLRLIFT CCHPALAQEA QLALTLRLVC GLSTPDTARM LLVSESTMAA RITRAKKKIS       180
     AARIPFRVPR AAELPDRLGA VLGVVHLLFT AGHTAPSGPD LLRTELTDRA LFLARTLRDL       240
     MPDEPEVRGL LALFLVTDTR RATRTDADGR LLRLEEQDRS QWDGEALAEA HELIVAGLRG       300
     GRAGRYLLQA AIASLYAQAP TYEETDWSQL VVLYDRLLAV WPSPTVALNR TVPLSMAQGP       360
     EKAFDAVAEL EKDDRLARYP YLPAIKADLW RRLGRDAEAT KAYRQALELT DNEAERAFLA       420
     GRAGETGPPV R                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page