(data stored in ACNUC7421 zone)

EMBL: CP001700.PE546

CP001700.PE546       Location/Qualifiers
FT   CDS             648081..649745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69501"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69501.1"
FT                   /translation="MSRKPRSLKQIQVQLSEQLRASDHSWADIGREFQRRFHVNARVAL
FT                   RQARGWTQPEAAERWNRRWPEDPKTFKNFSYWEAWPSSTGYAPSLEVLDRMAQLYECSV
FT                   ADLLSDLDDYGAKKRPLFSQIREPGPGGSMSLPPPRQAPQSYALAAAVQNPDVRFDPYF
FT                   GAPPPKPLRDDVGTNPGELLSSMSSAAEISSLIEPPDGGNSLSRRSALLNLSSLFAVAA
FT                   AAPLAGEAVLPTPAGRVDPAMVENTGLIVGGLRQQNAALGPSATLQTGLAVRAMMEAVV
FT                   KDAPPGLTGQAWVVYGDLAHLLGWMMFNMGQDEAARFYYDDARKAAYQADDYELAANIL
FT                   AAQAHLSMSAGDHQTAIDHAQAAEEAAKRSPSRRAKAYAADMTARVYASAGQGARSLAA
FT                   LERERRQMQRIDWAEPAAERWGFYGPAFYWARESECHLLLGHPVEAADAGALAQQRFNP
FT                   AYLHNNAMALARRAQAQVQFGDVPAACKALAEAARMATLAGSVRLTTEMTRARKQLAPY
FT                   NGEAVVQALDVRLDHYAKQRGAVDNGGRPANSMEEVL"
     MSRKPRSLKQ IQVQLSEQLR ASDHSWADIG REFQRRFHVN ARVALRQARG WTQPEAAERW        60
     NRRWPEDPKT FKNFSYWEAW PSSTGYAPSL EVLDRMAQLY ECSVADLLSD LDDYGAKKRP       120
     LFSQIREPGP GGSMSLPPPR QAPQSYALAA AVQNPDVRFD PYFGAPPPKP LRDDVGTNPG       180
     ELLSSMSSAA EISSLIEPPD GGNSLSRRSA LLNLSSLFAV AAAAPLAGEA VLPTPAGRVD       240
     PAMVENTGLI VGGLRQQNAA LGPSATLQTG LAVRAMMEAV VKDAPPGLTG QAWVVYGDLA       300
     HLLGWMMFNM GQDEAARFYY DDARKAAYQA DDYELAANIL AAQAHLSMSA GDHQTAIDHA       360
     QAAEEAAKRS PSRRAKAYAA DMTARVYASA GQGARSLAAL ERERRQMQRI DWAEPAAERW       420
     GFYGPAFYWA RESECHLLLG HPVEAADAGA LAQQRFNPAY LHNNAMALAR RAQAQVQFGD       480
     VPAACKALAE AARMATLAGS VRLTTEMTRA RKQLAPYNGE AVVQALDVRL DHYAKQRGAV       540
     DNGGRPANSM EEVL                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page