(data stored in ACNUC7421 zone)

EMBL: CP001700.PE548

CP001700.PE548       Location/Qualifiers
FT   CDS             complement(650697..652721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0566"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   afw:Anae109_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69503"
FT                   /db_xref="GOA:C7PXF2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF2"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACU69503.1"
FT                   /translation="MDSPWIFTAFRAPADPGAAPDALQEIRHLRARILFDEGRRPAFRS
FT                   RAGDHADDQPQDHGAWHFAARRARDGAHGPPLGYVRLLTPVTASLYQSREFLGSTHYEE
FT                   VLSTEGLNPAAVFEHSRLVVEHRARKLGLGLHLNALAVAAAHELGAAAMIGTSGTADGQ
FT                   DRFHARFGFHPVPGTRRYVEKYTEDVVILLHRTEEGAGEHTALVDEYRLLFRYDLMEDA
FT                   GLAEPSVPLARSAQSSLSSLSSLSSRSAAKAEPSFTVPDRGPVWRDAPPRRLTAIGPSD
FT                   PHRWKPVLFEPAQPDARAAMTSLLNTGAVREVLDTVDAQLEELIRARDPGRVFDADALA
FT                   DARSDQLEGARPWAYGTWAWYPWSGRLVHVLPREEFRLVRTDRNRGKIDRPEQRRLLDK
FT                   RIGVIGLSVGNSAALTLAQEGVAGAFKLADFDTLSVSNLNRLRAGLHQIGVNKAVLAAR
FT                   QMFEIDPYLDIEIFPAGLTEDTVREFFLGGHGPIDLLVEECDTPWVKLAAREAARDLGV
FT                   PVVMDANDRGLLDIERFDREPHRPLLHGLLGALTPDDCLDLTFAERVDLILAMVDADRV
FT                   SPALAASIPEIGRTLSSWPQLASGVALGGALVTEAARRILLGSPCPSGRFYVDLEELIR
FT                   ADKNVVGATDSPGGTASGDPGPDPDPDPAQAAVSLPSAP"
     MDSPWIFTAF RAPADPGAAP DALQEIRHLR ARILFDEGRR PAFRSRAGDH ADDQPQDHGA        60
     WHFAARRARD GAHGPPLGYV RLLTPVTASL YQSREFLGST HYEEVLSTEG LNPAAVFEHS       120
     RLVVEHRARK LGLGLHLNAL AVAAAHELGA AAMIGTSGTA DGQDRFHARF GFHPVPGTRR       180
     YVEKYTEDVV ILLHRTEEGA GEHTALVDEY RLLFRYDLME DAGLAEPSVP LARSAQSSLS       240
     SLSSLSSRSA AKAEPSFTVP DRGPVWRDAP PRRLTAIGPS DPHRWKPVLF EPAQPDARAA       300
     MTSLLNTGAV REVLDTVDAQ LEELIRARDP GRVFDADALA DARSDQLEGA RPWAYGTWAW       360
     YPWSGRLVHV LPREEFRLVR TDRNRGKIDR PEQRRLLDKR IGVIGLSVGN SAALTLAQEG       420
     VAGAFKLADF DTLSVSNLNR LRAGLHQIGV NKAVLAARQM FEIDPYLDIE IFPAGLTEDT       480
     VREFFLGGHG PIDLLVEECD TPWVKLAARE AARDLGVPVV MDANDRGLLD IERFDREPHR       540
     PLLHGLLGAL TPDDCLDLTF AERVDLILAM VDADRVSPAL AASIPEIGRT LSSWPQLASG       600
     VALGGALVTE AARRILLGSP CPSGRFYVDL EELIRADKNV VGATDSPGGT ASGDPGPDPD       660
     PDPAQAAVSL PSAP                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page