(data stored in ACNUC7421 zone)

EMBL: CP001700.PE549

CP001700.PE549       Location/Qualifiers
FT   CDS             652838..653857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0567"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: fre:Franean1_5756 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69504"
FT                   /db_xref="GOA:C7PXF3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXF3"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69504.1"
FT                   /translation="MTTRAAVVQGVGGCVPPRSVDNNELSSRLETSDAWIRERLGIGRR
FT                   YVADGVSTVDLAVEAGARALEMADAGAGLGPLDVVLLATTTPDRLCPASAPEVASRLGY
FT                   TGIAAFDVNAVCAGFVHALATGNALIRGHMADRVLVIGADTFTTLVDPADRLTASIFGD
FT                   GAGALVLRAGTPDEPGALRAFDLGSDGSQVATVEVPGGGARDRLGMPVANQRPYLVMDG
FT                   PAVFRRAVQEMTASSLRVLAKAKWDAGSVRRFVPHQANIRIIRGVAERLGIGAERVVAN
FT                   IEDVGNTVAASIPLALADAHDSGRLGAGERVLMTSIGAGLAWGSAVLTWPELQGKARL"
     MTTRAAVVQG VGGCVPPRSV DNNELSSRLE TSDAWIRERL GIGRRYVADG VSTVDLAVEA        60
     GARALEMADA GAGLGPLDVV LLATTTPDRL CPASAPEVAS RLGYTGIAAF DVNAVCAGFV       120
     HALATGNALI RGHMADRVLV IGADTFTTLV DPADRLTASI FGDGAGALVL RAGTPDEPGA       180
     LRAFDLGSDG SQVATVEVPG GGARDRLGMP VANQRPYLVM DGPAVFRRAV QEMTASSLRV       240
     LAKAKWDAGS VRRFVPHQAN IRIIRGVAER LGIGAERVVA NIEDVGNTVA ASIPLALADA       300
     HDSGRLGAGE RVLMTSIGAG LAWGSAVLTW PELQGKARL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page