(data stored in ACNUC7421 zone)

EMBL: CP001700.PE55

CP001700.PE55        Location/Qualifiers
FT   CDS             complement(56106..57116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0055"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: sma:SAV_4367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69010"
FT                   /db_xref="GOA:C7QFS1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFS1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69010.1"
FT                   /translation="MLPRAVPGPLRAVLKRVLLALGILVLSAVIVYLGRDGYRDSSGKP
FT                   IGWLTSFYYATVTLSTTGYGDVVPVSDSARLISTLFVTPLRVLFLLVLVGTTLEVLTER
FT                   TRNEWRQERWRSKVRDHTVVVGYGTKGSSAVQTLLKHGTTPESIVVVDTDPARIAEANR
FT                   RGLVGIVGDGSRSEVLERAEISKARHVVISAERDDTAVLTTLTVRRLTRRATVVASVRE
FT                   AENAPLLRESGASSVVTSSDTAGQLLGMATISPKVSQVVHDLLSHGEGLELLERPADTG
FT                   DVDKDPRALKEPVLAVIRGSRTMRFDDVAIGTIQLTDRLVVVRSVHNRRTDPGRR"
     MLPRAVPGPL RAVLKRVLLA LGILVLSAVI VYLGRDGYRD SSGKPIGWLT SFYYATVTLS        60
     TTGYGDVVPV SDSARLISTL FVTPLRVLFL LVLVGTTLEV LTERTRNEWR QERWRSKVRD       120
     HTVVVGYGTK GSSAVQTLLK HGTTPESIVV VDTDPARIAE ANRRGLVGIV GDGSRSEVLE       180
     RAEISKARHV VISAERDDTA VLTTLTVRRL TRRATVVASV REAENAPLLR ESGASSVVTS       240
     SDTAGQLLGM ATISPKVSQV VHDLLSHGEG LELLERPADT GDVDKDPRAL KEPVLAVIRG       300
     SRTMRFDDVA IGTIQLTDRL VVVRSVHNRR TDPGRR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page