(data stored in ACNUC7421 zone)

EMBL: CP001700.PE550

CP001700.PE550       Location/Qualifiers
FT   CDS             complement(654056..655348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0568"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   sgr:SGR_3807 putative NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69505"
FT                   /db_xref="GOA:C7PYU9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYU9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU69505.1"
FT                   /translation="MSAYEAADNAFGDEGYPPPGNSAWFGGAPGVPALPGDGAPANGHE
FT                   FAPAAGFGTAPGGFGAAIGTAFADAGFGAMPTGGGDFGGANGAGFGGANGSGSGGASGT
FT                   GSGGANGASYGGANGGGYGAGDGFGGTNGSGSGSGGANGAGFGASHSSGTGSGSTSGRT
FT                   ALPDYPASSPNAVAYTDPGFGRQDFSAPPATRHAADPTSSSALLPALAHPGPPRPGPAG
FT                   DVLRLVAVTAGLGQPSTARILADRLAEAARARLGERGRQVLVEVLELRDLALDIAGAMV
FT                   AGFPGAKLRAALDAVEGADGLIAVSPIYTASYSGLFKSFFDVLDKDALTGKPTLIAATG
FT                   GTARHSLALDHALRPMFAYLRAFMVPTAVFAASEDWASTGENSLNERISRAGTELGDLM
FT                   AGTPAAGRRRRDEFEDVVPFEQRMAALRSGI"
     MSAYEAADNA FGDEGYPPPG NSAWFGGAPG VPALPGDGAP ANGHEFAPAA GFGTAPGGFG        60
     AAIGTAFADA GFGAMPTGGG DFGGANGAGF GGANGSGSGG ASGTGSGGAN GASYGGANGG       120
     GYGAGDGFGG TNGSGSGSGG ANGAGFGASH SSGTGSGSTS GRTALPDYPA SSPNAVAYTD       180
     PGFGRQDFSA PPATRHAADP TSSSALLPAL AHPGPPRPGP AGDVLRLVAV TAGLGQPSTA       240
     RILADRLAEA ARARLGERGR QVLVEVLELR DLALDIAGAM VAGFPGAKLR AALDAVEGAD       300
     GLIAVSPIYT ASYSGLFKSF FDVLDKDALT GKPTLIAATG GTARHSLALD HALRPMFAYL       360
     RAFMVPTAVF AASEDWASTG ENSLNERISR AGTELGDLMA GTPAAGRRRR DEFEDVVPFE       420
     QRMAALRSGI                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page