(data stored in ACNUC7421 zone)

EMBL: CP001700.PE551

CP001700.PE551       Location/Qualifiers
FT   CDS             complement(655345..656469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0569"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sco:SCO3296 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69506"
FT                   /db_xref="GOA:C7PYV0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69506.1"
FT                   /translation="MSQMQFGVFTVGDVTPDPTTGRAPTEHERIKAMVTIAEHAEQAGL
FT                   DVFATGEHHNPPFVPSSPTTLLGWIAGRTSKLLLSTATTLITTNDPVKIAEDYAMLQHL
FT                   ADGRVDLTLGRGNTGPVYPWFGKDIRDGIDLALENYALLRRLWDEDVVDWSGRFRTPLQ
FT                   NFTAAPRPLDGVAPFVWHGSIRSPEIAEQAAYYGDGFFHNNIFWPKEHTQRMVALYRRR
FT                   FAHYGHGTEEQAIVGLGGQVFMRKNSQDAVREFRPYFDNAPVYGHGPSLEEFTAETPLT
FT                   VGSPEQVVERTLSFRAYAGDYQRQLFLLDHAGLPLKTVLEQIDLLGAEVVPVLRKEFAI
FT                   GRPAGVPDAPTHASLTARHDERSALSDTKEAIAP"
     MSQMQFGVFT VGDVTPDPTT GRAPTEHERI KAMVTIAEHA EQAGLDVFAT GEHHNPPFVP        60
     SSPTTLLGWI AGRTSKLLLS TATTLITTND PVKIAEDYAM LQHLADGRVD LTLGRGNTGP       120
     VYPWFGKDIR DGIDLALENY ALLRRLWDED VVDWSGRFRT PLQNFTAAPR PLDGVAPFVW       180
     HGSIRSPEIA EQAAYYGDGF FHNNIFWPKE HTQRMVALYR RRFAHYGHGT EEQAIVGLGG       240
     QVFMRKNSQD AVREFRPYFD NAPVYGHGPS LEEFTAETPL TVGSPEQVVE RTLSFRAYAG       300
     DYQRQLFLLD HAGLPLKTVL EQIDLLGAEV VPVLRKEFAI GRPAGVPDAP THASLTARHD       360
     ERSALSDTKE AIAP                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page