(data stored in ACNUC7421 zone)

EMBL: CP001700.PE552

CP001700.PE552       Location/Qualifiers
FT   CDS             complement(656558..657637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4408 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69507"
FT                   /db_xref="GOA:C7PYV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69507.1"
FT                   /translation="MAQVKDPTPVKDHAVRLVRFQRIEIDATRLVLSGIALALPVAIGA
FT                   ATDRLADGLTAVLGALLVSAAGHEGGWRARCVDLGASAAVGALVVWLGALIGAHGNLAS
FT                   VWIVAMAFGAAMAGGIGTLEARIAANATVFTVIGAHLGTGPESPGHIVLYVALGMAAAA
FT                   ALTLGTHALGRALSPLRRRELEGPPGPEWPFRRSVPKWRAGLRTWHGWQYAVRLVTSIA
FT                   VAEVVSQFRPGAHTYWIALTVTLVVLRDEAAAPMRALERGLGTTIGVLVGGGLIGVLPT
FT                   WGIVALIGVIGAVRPYLKLANYTAYAAVMTPLITMLNELGNDISWAVLRERVLDTLIGC
FT                   AIGLCVGYLPWRMWANRQR"
     MAQVKDPTPV KDHAVRLVRF QRIEIDATRL VLSGIALALP VAIGAATDRL ADGLTAVLGA        60
     LLVSAAGHEG GWRARCVDLG ASAAVGALVV WLGALIGAHG NLASVWIVAM AFGAAMAGGI       120
     GTLEARIAAN ATVFTVIGAH LGTGPESPGH IVLYVALGMA AAAALTLGTH ALGRALSPLR       180
     RRELEGPPGP EWPFRRSVPK WRAGLRTWHG WQYAVRLVTS IAVAEVVSQF RPGAHTYWIA       240
     LTVTLVVLRD EAAAPMRALE RGLGTTIGVL VGGGLIGVLP TWGIVALIGV IGAVRPYLKL       300
     ANYTAYAAVM TPLITMLNEL GNDISWAVLR ERVLDTLIGC AIGLCVGYLP WRMWANRQR        359
//

If you have problems or comments...

PBIL Back to PBIL home page