(data stored in ACNUC7421 zone)

EMBL: CP001700.PE553

CP001700.PE553       Location/Qualifiers
FT   CDS             657708..658031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0571"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   sma:SAV_7285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69508"
FT                   /db_xref="GOA:C7PYV2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV2"
FT                   /inference="protein motif:PFAM:PF05336"
FT                   /protein_id="ACU69508.1"
FT                   /translation="MRGVLVRVAIHTRLKPEGVTGYEQAHDDIPPEIPELLRAGGCTAW
FT                   TIWRNGVDLFHLVECEDWEALRAFLADKDDDRAWQARVGVFRDFSLVGGDQPLPMIFEL
FT                   PEG"
     MRGVLVRVAI HTRLKPEGVT GYEQAHDDIP PEIPELLRAG GCTAWTIWRN GVDLFHLVEC        60
     EDWEALRAFL ADKDDDRAWQ ARVGVFRDFS LVGGDQPLPM IFELPEG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page