(data stored in ACNUC7421 zone)

EMBL: CP001700.PE554

CP001700.PE554       Location/Qualifiers
FT   CDS             658034..658873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0572"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sma:SAV_7286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69509"
FT                   /db_xref="GOA:C7PYV3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV3"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU69509.1"
FT                   /translation="MRIIDAHHHLWDLAVRDQPWTAELPALRRSFLLSDLEPLAAAAGV
FT                   SATVLVQTIHAADETPEMLALAETSDLVAGVVGWTDVAAPDFGERLSELRSGVGGRRLV
FT                   GIRHQVQELPDGGWLTRPDTRRGLRQLASNGLAFDLIVRADQIPACVAAARALPDLRFV
FT                   LDHLGKPNIASGEREPWASDIRALAELPNVACKLSGMVTEADAERWTVADLRPYSDLVL
FT                   EAFGPERLMFGSDWPVSTLAAGYPQVVETAMQLTSELSEAEREAVFGGTATEVYGLG"
     MRIIDAHHHL WDLAVRDQPW TAELPALRRS FLLSDLEPLA AAAGVSATVL VQTIHAADET        60
     PEMLALAETS DLVAGVVGWT DVAAPDFGER LSELRSGVGG RRLVGIRHQV QELPDGGWLT       120
     RPDTRRGLRQ LASNGLAFDL IVRADQIPAC VAAARALPDL RFVLDHLGKP NIASGEREPW       180
     ASDIRALAEL PNVACKLSGM VTEADAERWT VADLRPYSDL VLEAFGPERL MFGSDWPVST       240
     LAAGYPQVVE TAMQLTSELS EAEREAVFGG TATEVYGLG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page