(data stored in ACNUC7421 zone)

EMBL: CP001700.PE555

CP001700.PE555       Location/Qualifiers
FT   CDS             complement(658881..659699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0573"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   stp:Strop_2137 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69510"
FT                   /db_xref="GOA:C7PYV4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV4"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU69510.1"
FT                   /translation="MRAHHRVASRNARFQQWQTLLTNRQKRQRAGRFLVQGVRPLTLAA
FT                   EQGWRIEELLVDDDRRLSRWAEDFLDAAHTADADVIALPADMLAELGEKDQEAAPELLA
FT                   VVAMPPDDLIRIQITDTFLGVAFDRPAQPGNLGTLIRSADAFGADGVVVTGHAADVYDP
FT                   RTVRASTGSLFGLPTVRTQSHREVLEWLSETGVTVVGTDEDGDTDIEDYDFCAPTLFVV
FT                   GNEAVGMSTGWREACDRVLSIPMRGTASSLNAANAATVVLYEAARQRRQK"
     MRAHHRVASR NARFQQWQTL LTNRQKRQRA GRFLVQGVRP LTLAAEQGWR IEELLVDDDR        60
     RLSRWAEDFL DAAHTADADV IALPADMLAE LGEKDQEAAP ELLAVVAMPP DDLIRIQITD       120
     TFLGVAFDRP AQPGNLGTLI RSADAFGADG VVVTGHAADV YDPRTVRAST GSLFGLPTVR       180
     TQSHREVLEW LSETGVTVVG TDEDGDTDIE DYDFCAPTLF VVGNEAVGMS TGWREACDRV       240
     LSIPMRGTAS SLNAANAATV VLYEAARQRR QK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page