(data stored in ACNUC7421 zone)

EMBL: CP001700.PE556

CP001700.PE556       Location/Qualifiers
FT   CDS             659717..660592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0574"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   bph:Bphy_2889 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69511"
FT                   /db_xref="GOA:C7PYV5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69511.1"
FT                   /translation="MAEPEDPSTSPQNSQPSQASPTYDDAERVLWADAGSGYEAVYAAL
FT                   CAHTIPALLDGAGVQDGSALLDVGTGTGTLVRAAVARGARVTAVDAEPSMLALARGKAP
FT                   EAEFLLAVVPDLPFEPDTFDAVVGNFVLDHFGRPKVAMRALRAIAKPGGRVAFTLWPAE
FT                   RSAGRSVFSRTGAMTEGWIPRQMPPLVLADDYPRTEEGLAGLFREIGLADVTTTVIDWE
FT                   HLTTAEEWWISMGSGVGPSGRTYQAQTPEVRAAFHENYLRVAAEMTDAEGTMRLPYRAL
FT                   LAVGTVVDSE"
     MAEPEDPSTS PQNSQPSQAS PTYDDAERVL WADAGSGYEA VYAALCAHTI PALLDGAGVQ        60
     DGSALLDVGT GTGTLVRAAV ARGARVTAVD AEPSMLALAR GKAPEAEFLL AVVPDLPFEP       120
     DTFDAVVGNF VLDHFGRPKV AMRALRAIAK PGGRVAFTLW PAERSAGRSV FSRTGAMTEG       180
     WIPRQMPPLV LADDYPRTEE GLAGLFREIG LADVTTTVID WEHLTTAEEW WISMGSGVGP       240
     SGRTYQAQTP EVRAAFHENY LRVAAEMTDA EGTMRLPYRA LLAVGTVVDS E                291
//

If you have problems or comments...

PBIL Back to PBIL home page