(data stored in ACNUC7421 zone)

EMBL: CP001700.PE557

CP001700.PE557       Location/Qualifiers
FT   CDS             complement(660744..661550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0575"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   NADP oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   oan:Oant_3760 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69512"
FT                   /db_xref="GOA:C7PYV6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV6"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACU69512.1"
FT                   /translation="MTTKVAFLGLGAMGAPMAARVIGAGYEVVVWNRTAARTEPLVALG
FT                   AGAAADPAGAVAGAEFVITMLSDPAAVTAVAEAIAGALRPDAVLVEMSTIGPDGTERIR
FT                   GLIPASVGLVDAPVMGSVDRAADGTLAVLAGGTPQDLARVADLLKLFGNVTECGGPGTG
FT                   SARKLVLISGIVAGVAVVGETLALAEKLGLPDPRAVLEASPLGGLVARAFATGVDFSAE
FT                   MAAKDLRLAGEVLDLPVIAAAQRALEAVPDPDADLGEAVRALNAKR"
     MTTKVAFLGL GAMGAPMAAR VIGAGYEVVV WNRTAARTEP LVALGAGAAA DPAGAVAGAE        60
     FVITMLSDPA AVTAVAEAIA GALRPDAVLV EMSTIGPDGT ERIRGLIPAS VGLVDAPVMG       120
     SVDRAADGTL AVLAGGTPQD LARVADLLKL FGNVTECGGP GTGSARKLVL ISGIVAGVAV       180
     VGETLALAEK LGLPDPRAVL EASPLGGLVA RAFATGVDFS AEMAAKDLRL AGEVLDLPVI       240
     AAAQRALEAV PDPDADLGEA VRALNAKR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page