(data stored in ACNUC7421 zone)

EMBL: CP001700.PE558

CP001700.PE558       Location/Qualifiers
FT   CDS             complement(661606..662358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1027 DivIVA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69513"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69513.1"
FT                   /translation="MSFNEYDGAPGGTGARRPERLSAEQIDAWEFPRAGLAHRGFDEEG
FT                   VLRFKRRVLGELQAAAQIETELRQRNDELTNQLRTTYAGSDPANGGAAAAPAAPSSFAP
FT                   EQRVTAAAVNAIAMAQRQAEEQIRAAEEYVRNVTEYARNQYTVTVNEGHRQGLLAAESA
FT                   FQRRSEQLSTSLHSLEQQLEFLKAFGVAFGVQVEGALEKAREEVHVMIKNIHQAFDALN
FT                   RNPPQSAGAPPVMGMAGLHAGSALPGTA"
     MSFNEYDGAP GGTGARRPER LSAEQIDAWE FPRAGLAHRG FDEEGVLRFK RRVLGELQAA        60
     AQIETELRQR NDELTNQLRT TYAGSDPANG GAAAAPAAPS SFAPEQRVTA AAVNAIAMAQ       120
     RQAEEQIRAA EEYVRNVTEY ARNQYTVTVN EGHRQGLLAA ESAFQRRSEQ LSTSLHSLEQ       180
     QLEFLKAFGV AFGVQVEGAL EKAREEVHVM IKNIHQAFDA LNRNPPQSAG APPVMGMAGL       240
     HAGSALPGTA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page