(data stored in ACNUC7421 zone)

EMBL: CP001700.PE559

CP001700.PE559       Location/Qualifiers
FT   CDS             complement(662355..663470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0577"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: sen:SACE_7206 flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69514"
FT                   /db_xref="GOA:C7PYV8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69514.1"
FT                   /translation="MDPHLLRTSWAKVAQYGEQVPLFFYGHLFLSHPEVRAMFPPSMAA
FT                   QRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHRKFAVEPGHYPAVGASLLATLEQFLG
FT                   PDWTPAVAESWTEAYGIVAKVMTDAAAAASESTPPWWEAEIVAHEVVGGRRDIARVTIA
FT                   TRQPYAYTAGQSMTLETAMAPARWRFYTPANPPRQDGLIELHIKLVGAVSWQLVNIMGV
FT                   GDRLRLGPPVGYQLTLASTAPGTDLLLIAGSTGVAPLRAIVEELARTPDHGRHVTLFYG
FT                   ARIGSDLYDLPRLEQLAAHHGWLSVIPVVSDDHAWEGRHGLVGDIAAAYGNWPGHEVFI
FT                   VGSAGMCEHTAARLKEAGVIPGAIHLEESQP"
     MDPHLLRTSW AKVAQYGEQV PLFFYGHLFL SHPEVRAMFP PSMAAQRDRL VAALGAVVAN        60
     VDNLDSAVPF LQGLGRDHRK FAVEPGHYPA VGASLLATLE QFLGPDWTPA VAESWTEAYG       120
     IVAKVMTDAA AAASESTPPW WEAEIVAHEV VGGRRDIARV TIATRQPYAY TAGQSMTLET       180
     AMAPARWRFY TPANPPRQDG LIELHIKLVG AVSWQLVNIM GVGDRLRLGP PVGYQLTLAS       240
     TAPGTDLLLI AGSTGVAPLR AIVEELARTP DHGRHVTLFY GARIGSDLYD LPRLEQLAAH       300
     HGWLSVIPVV SDDHAWEGRH GLVGDIAAAY GNWPGHEVFI VGSAGMCEHT AARLKEAGVI       360
     PGAIHLEESQ P                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page