(data stored in ACNUC7421 zone)

EMBL: CP001700.PE56

CP001700.PE56        Location/Qualifiers
FT   CDS             complement(57158..58456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0056"
FT                   /product="MoeA domain protein domain I and II"
FT                   /note="PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: sco:SCO3827 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69011"
FT                   /db_xref="GOA:C7QH72"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH72"
FT                   /inference="protein motif:PFAM:PF03453"
FT                   /protein_id="ACU69011.1"
FT                   /translation="MSTSWAEARKIAGAAAIPLPVTRVPLAQARGTVLAESLSALVDLP
FT                   PFATSAMDGWAVAGPGPWRVTGRVLAGQEATRLGDGEAVEIATGARMPSGAEAVLRRER
FT                   GYVDAHSRLHVGEKGDDQDGPNHGASAAATTAAAPQRFYAAVTSGTTATRTPRGAELGL
FT                   PIGADIRPQGQESRRGETLLSAGTRVTPAVLGLAAAAGYDDLPVHERPRVALVVIGDEL
FT                   AGSGLPDGARIRDALGPMFTAWLDALGVEVTVSRVADDPRELLAVVASSPADLVITTGG
FT                   TARGPVDHVHRVLAELGARLLIDGVSVRPGHPMLLAQYGGTRQHRRFVAGLPGNPLAAV
FT                   AGFVTVVRPLLRRLAGLADTSHFLPLGDAVPTHPTDTRLVPVSVTEASAVPLRFTGPAM
FT                   LRGLALADGLAVVPPGGGVVALGAGQRVEVLTV"
     MSTSWAEARK IAGAAAIPLP VTRVPLAQAR GTVLAESLSA LVDLPPFATS AMDGWAVAGP        60
     GPWRVTGRVL AGQEATRLGD GEAVEIATGA RMPSGAEAVL RRERGYVDAH SRLHVGEKGD       120
     DQDGPNHGAS AAATTAAAPQ RFYAAVTSGT TATRTPRGAE LGLPIGADIR PQGQESRRGE       180
     TLLSAGTRVT PAVLGLAAAA GYDDLPVHER PRVALVVIGD ELAGSGLPDG ARIRDALGPM       240
     FTAWLDALGV EVTVSRVADD PRELLAVVAS SPADLVITTG GTARGPVDHV HRVLAELGAR       300
     LLIDGVSVRP GHPMLLAQYG GTRQHRRFVA GLPGNPLAAV AGFVTVVRPL LRRLAGLADT       360
     SHFLPLGDAV PTHPTDTRLV PVSVTEASAV PLRFTGPAML RGLALADGLA VVPPGGGVVA       420
     LGAGQRVEVL TV                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page