(data stored in ACNUC7421 zone)

EMBL: CP001700.PE560

CP001700.PE560       Location/Qualifiers
FT   CDS             complement(663476..663859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0578"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mgi:Mflv_3264 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69515"
FT                   /db_xref="GOA:C7PYV9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYV9"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACU69515.1"
FT                   /translation="MSESQNQSQWERVGGEAAIKAVLDRFYEGVLDEPQLAGFFESVAV
FT                   DDIKPHMAEVLQVVLGGPGARTDIDLAGYLTEAHADLGVSLSDFELTGKVLLDTLEEFS
FT                   VPDDIVETIEGVLATVQPFVVAA"
     MSESQNQSQW ERVGGEAAIK AVLDRFYEGV LDEPQLAGFF ESVAVDDIKP HMAEVLQVVL        60
     GGPGARTDID LAGYLTEAHA DLGVSLSDFE LTGKVLLDTL EEFSVPDDIV ETIEGVLATV       120
     QPFVVAA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page