(data stored in ACNUC7421 zone)

EMBL: CP001700.PE561

CP001700.PE561       Location/Qualifiers
FT   CDS             complement(664125..665069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0579"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sgr:SGR_3027
FT                   putative Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69516"
FT                   /db_xref="GOA:C7PYW0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69516.1"
FT                   /translation="MSSSLSDRRTDARFRADRNLSARMLSVMVLLAAVYGAAILLMIRF
FT                   MGRAWPLGLAVVVAFAVFQILTSGKVAMRTMGAREVSAEEEPELHALVDRLCALSGMKK
FT                   PTIAVAESRIPNACAVGRSKGGATLCVTRSLLDTLDPPELEGVIAHEMAHIEHGDAAVM
FT                   TVAAFVGVLAGLVARVGLRFIYIGGRARGLWHIIVAAIGLIALATATWFVSLVLTRSLS
FT                   RYREFAADRSAAQLTGNPSALASALAKVEAKVHGGGGIPQTDLRKAGALNAFYFAPVTS
FT                   AKTTAHHLLSTHPTTQARLDRLVKMSTEMSKNG"
     MSSSLSDRRT DARFRADRNL SARMLSVMVL LAAVYGAAIL LMIRFMGRAW PLGLAVVVAF        60
     AVFQILTSGK VAMRTMGARE VSAEEEPELH ALVDRLCALS GMKKPTIAVA ESRIPNACAV       120
     GRSKGGATLC VTRSLLDTLD PPELEGVIAH EMAHIEHGDA AVMTVAAFVG VLAGLVARVG       180
     LRFIYIGGRA RGLWHIIVAA IGLIALATAT WFVSLVLTRS LSRYREFAAD RSAAQLTGNP       240
     SALASALAKV EAKVHGGGGI PQTDLRKAGA LNAFYFAPVT SAKTTAHHLL STHPTTQARL       300
     DRLVKMSTEM SKNG                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page