(data stored in ACNUC7421 zone)

EMBL: CP001700.PE562

CP001700.PE562       Location/Qualifiers
FT   CDS             complement(665201..666250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_6654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69517"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW1"
FT                   /inference="similar to AA sequence:KEGG:SACE_6654"
FT                   /protein_id="ACU69517.1"
FT                   /translation="MTENWQQEPAPRLSTARDRAEAGPESIPVMPHGLKPVPMSRPGGP
FT                   RPDAPAPPYQPQSRWQEPQVYIANTYIDSPYTPPTPPPSQPPPTADPRIGNSRVGNPSD
FT                   GNSTMMVAVGTVQPAASRPPEVSTVEEAERILGYAVDSLDADPDLYSIGTVTDGAVCLI
FT                   PDDGRWSIFLADGGRRRYAGSFDNPEQAAIHFAGVLLIAAAERGALPKHAAGRAALPGR
FT                   STDPLAEMLAGPPITPLAGDPPTTLYSDQRLTILTPGTEVDRFGDQQGNTVYAARTRYP
FT                   HRSLPPDYIGRPYRVYRVRDPLRALTGTAIPWFGQPGGGMAYLLPRPIRDLLHEGALVE
FT                   IPSATLAPS"
     MTENWQQEPA PRLSTARDRA EAGPESIPVM PHGLKPVPMS RPGGPRPDAP APPYQPQSRW        60
     QEPQVYIANT YIDSPYTPPT PPPSQPPPTA DPRIGNSRVG NPSDGNSTMM VAVGTVQPAA       120
     SRPPEVSTVE EAERILGYAV DSLDADPDLY SIGTVTDGAV CLIPDDGRWS IFLADGGRRR       180
     YAGSFDNPEQ AAIHFAGVLL IAAAERGALP KHAAGRAALP GRSTDPLAEM LAGPPITPLA       240
     GDPPTTLYSD QRLTILTPGT EVDRFGDQQG NTVYAARTRY PHRSLPPDYI GRPYRVYRVR       300
     DPLRALTGTA IPWFGQPGGG MAYLLPRPIR DLLHEGALVE IPSATLAPS                   349
//

If you have problems or comments...

PBIL Back to PBIL home page