(data stored in ACNUC7421 zone)

EMBL: CP001700.PE563

CP001700.PE563       Location/Qualifiers
FT   CDS             complement(666299..667126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0581"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7067 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69518"
FT                   /db_xref="GOA:C7PYW2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69518.1"
FT                   /translation="MELSYARRGSGEPLVLIHGIGHRWQAWEPVLDRLAEHHDVIAIDI
FT                   PGFGKSAPLKLAAGQHPTIGLAMERIAESFPGFGIERPHVAGNSLGGALALELARHGLA
FT                   ASATAFSPAGFWHTRWETAWALGNLSLTRAAAFAPEPVLRYIADHETTRALAFGMIFGK
FT                   PRRLDPALALADTLALRAGRSFRPVGREAKHYRYAGESDVPTTVAWGTKDRILLRRQFA
FT                   QAKQVLPKARFEDLPGCGHVPMNDDPERVSRLILETTGALPAGTREVVGPSDL"
     MELSYARRGS GEPLVLIHGI GHRWQAWEPV LDRLAEHHDV IAIDIPGFGK SAPLKLAAGQ        60
     HPTIGLAMER IAESFPGFGI ERPHVAGNSL GGALALELAR HGLAASATAF SPAGFWHTRW       120
     ETAWALGNLS LTRAAAFAPE PVLRYIADHE TTRALAFGMI FGKPRRLDPA LALADTLALR       180
     AGRSFRPVGR EAKHYRYAGE SDVPTTVAWG TKDRILLRRQ FAQAKQVLPK ARFEDLPGCG       240
     HVPMNDDPER VSRLILETTG ALPAGTREVV GPSDL                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page