(data stored in ACNUC7421 zone)

EMBL: CP001700.PE564

CP001700.PE564       Location/Qualifiers
FT   CDS             complement(667233..668954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0582"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   sma:SAV_3592 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69519"
FT                   /db_xref="GOA:C7PYW3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW3"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACU69519.1"
FT                   /translation="MTSLAPTRSSLPDDDSEEDYGGRRRGRSGSHRERGRVWWRPNLDP
FT                   RDDEQGELTLRERLVPSFAREPWWVTWGFPLLITLVGGFMRFWHLGLPKWVIFDETYYA
FT                   KDAWATIHFGHEIGWHDDGPGVGMANDDHAIIANPHIWRTLVANHQGNAVHPPVGKWMI
FT                   GAGEWLFGFTPFGWRFIPAVCGTLAILMTARIARRMFRSTLIGCLAGVLLAADGLEFVM
FT                   SRTALLDIFVMFWTLAAFGCFLVDRDKMRSRLVDWRESFPSTPLPDDVKAPPLGWRPWR
FT                   IAGAVCLGLDLGTKWSGLWIIPCFIAMSLLWDHAALRAVGIRRHWSGFLRRETWQTTLL
FT                   GLLVLATYAATWTGWFVTKDGNYRQWAAQNNAIHVPVLSALRSWWEYHWQTYHFHVNLD
FT                   SPHAYMSNPWSWLVMGRPTDYYYCSKGATGCPPLAADQHQQVLALGTPPLWWFASLALV
FT                   WCCWRWIARRDWRAGSILCGMLAAWAFWLNYQHRTIFTFYAVAFVPFMCLAAAYLLGVI
FT                   VGRSDALQYRRVWGAVVAGAITVYILVMFIYFYPILSAQTITYNQWLDRMWWPSWI"
     MTSLAPTRSS LPDDDSEEDY GGRRRGRSGS HRERGRVWWR PNLDPRDDEQ GELTLRERLV        60
     PSFAREPWWV TWGFPLLITL VGGFMRFWHL GLPKWVIFDE TYYAKDAWAT IHFGHEIGWH       120
     DDGPGVGMAN DDHAIIANPH IWRTLVANHQ GNAVHPPVGK WMIGAGEWLF GFTPFGWRFI       180
     PAVCGTLAIL MTARIARRMF RSTLIGCLAG VLLAADGLEF VMSRTALLDI FVMFWTLAAF       240
     GCFLVDRDKM RSRLVDWRES FPSTPLPDDV KAPPLGWRPW RIAGAVCLGL DLGTKWSGLW       300
     IIPCFIAMSL LWDHAALRAV GIRRHWSGFL RRETWQTTLL GLLVLATYAA TWTGWFVTKD       360
     GNYRQWAAQN NAIHVPVLSA LRSWWEYHWQ TYHFHVNLDS PHAYMSNPWS WLVMGRPTDY       420
     YYCSKGATGC PPLAADQHQQ VLALGTPPLW WFASLALVWC CWRWIARRDW RAGSILCGML       480
     AAWAFWLNYQ HRTIFTFYAV AFVPFMCLAA AYLLGVIVGR SDALQYRRVW GAVVAGAITV       540
     YILVMFIYFY PILSAQTITY NQWLDRMWWP SWI                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page