(data stored in ACNUC7421 zone)

EMBL: CP001700.PE565

CP001700.PE565       Location/Qualifiers
FT   CDS             669023..669910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0583"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: sco:SCO3153
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69520"
FT                   /db_xref="GOA:C7PYW4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACU69520.1"
FT                   /translation="MTGTEPTPGLLVLAGTPIGQDEDASPRLAAELTAADVIATEDTRR
FT                   LKRLLRVLDLTPKARFVSYFEANESARTPDLLRDLLAGARVVVVTDAGMPSVSDPGYRL
FT                   VAAAVEAGVRVTAVPGPSAVLTALAVSGLPVDRFCFEGFLPRKGGGRSSRLTELSSEPR
FT                   TMVFFEAPHRLAASLADMAAALGTDRPAAVCRELTKTYEEIKRGTLADLAKWAADGEIR
FT                   GEITVVVGGALPGAGRDLSGAEIAELVFARETAGGLRRKEAIAEVAAELGLPKRDVFDA
FT                   VVAAKEAAEAADES"
     MTGTEPTPGL LVLAGTPIGQ DEDASPRLAA ELTAADVIAT EDTRRLKRLL RVLDLTPKAR        60
     FVSYFEANES ARTPDLLRDL LAGARVVVVT DAGMPSVSDP GYRLVAAAVE AGVRVTAVPG       120
     PSAVLTALAV SGLPVDRFCF EGFLPRKGGG RSSRLTELSS EPRTMVFFEA PHRLAASLAD       180
     MAAALGTDRP AAVCRELTKT YEEIKRGTLA DLAKWAADGE IRGEITVVVG GALPGAGRDL       240
     SGAEIAELVF ARETAGGLRR KEAIAEVAAE LGLPKRDVFD AVVAAKEAAE AADES            295
//

If you have problems or comments...

PBIL Back to PBIL home page