(data stored in ACNUC7421 zone)

EMBL: CP001700.PE566

CP001700.PE566       Location/Qualifiers
FT   CDS             complement(669986..670357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0584"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   mav:MAV_3971 death-on-curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69521"
FT                   /db_xref="GOA:C7PYW5"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW5"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACU69521.1"
FT                   /translation="MRYLTTADLLAITTAALGPNTPIRDPGMIASAAHRPRTTAFGEDA
FT                   YPDLHTKAAAILHSILRNHPLVDGNKRLAWVACRTFLAVNGADFTPDEDAAVDFVMRAA
FT                   ASELGDVEAIAAVLREWTG"
     MRYLTTADLL AITTAALGPN TPIRDPGMIA SAAHRPRTTA FGEDAYPDLH TKAAAILHSI        60
     LRNHPLVDGN KRLAWVACRT FLAVNGADFT PDEDAAVDFV MRAAASELGD VEAIAAVLRE       120
     WTG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page