(data stored in ACNUC7421 zone)

EMBL: CP001700.PE568

CP001700.PE568       Location/Qualifiers
FT   CDS             670631..672448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0586"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: tfu:Tfu_0389 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69523"
FT                   /db_xref="GOA:C7PYW7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW7"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACU69523.1"
FT                   /translation="MPSTQRTILTAVAWPYANGPRHIGHVSGFGVPSDVFSRYQRMAGN
FT                   RVLMVSGTDEHGTPILVQADKEGVTARELADRYNRVIAEDLQSLGLAYDLFTRTTTRNH
FT                   YAVVQEIFKGLYDNGYIFPKTTMGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNC
FT                   GNQLDPDRLIDPRSRINGETPKFIETEQFFLDLPAFASVLGGWLQQQKTWRPNVLKFSL
FT                   NLLDDLQPRAISRDLDWGVPVPLEGWVDRPDKKLYVWFDAVVGYLSASVEWARRTGDPD
FT                   AWRAFWQTGPNGEAPDAYYFMGKDNIVFHSEIWPAMLLGYDGRGEKNGKPGSLGALNLP
FT                   HEVVSSEFLTMEGRKFSSSRAVVIYVRDFLSRYDADALRYYITAAGPETQDTDFTWSEF
FT                   LRRNNDELVAGWGNLVNRAISMAAKNLGQIPAAKDLTAEDEALLATSRGAFAVVGDLLD
FT                   RCRFKAALAEAMRLVAEANKYVSDHEPWKLAKTDPERMATVLHVTLQVVDDAKTLLTPF
FT                   LPFSSEKVFHLLGGEGTWSAMPELREVEDLDGGPGYPVLTGDYEQALARWESTPIEAGR
FT                   PLAPPTPIFKKLDPSIVDEELARLGGEAA"
     MPSTQRTILT AVAWPYANGP RHIGHVSGFG VPSDVFSRYQ RMAGNRVLMV SGTDEHGTPI        60
     LVQADKEGVT ARELADRYNR VIAEDLQSLG LAYDLFTRTT TRNHYAVVQE IFKGLYDNGY       120
     IFPKTTMGAI SPSTGRTLPD RYIEGTCPIC GYDGARGDQC DNCGNQLDPD RLIDPRSRIN       180
     GETPKFIETE QFFLDLPAFA SVLGGWLQQQ KTWRPNVLKF SLNLLDDLQP RAISRDLDWG       240
     VPVPLEGWVD RPDKKLYVWF DAVVGYLSAS VEWARRTGDP DAWRAFWQTG PNGEAPDAYY       300
     FMGKDNIVFH SEIWPAMLLG YDGRGEKNGK PGSLGALNLP HEVVSSEFLT MEGRKFSSSR       360
     AVVIYVRDFL SRYDADALRY YITAAGPETQ DTDFTWSEFL RRNNDELVAG WGNLVNRAIS       420
     MAAKNLGQIP AAKDLTAEDE ALLATSRGAF AVVGDLLDRC RFKAALAEAM RLVAEANKYV       480
     SDHEPWKLAK TDPERMATVL HVTLQVVDDA KTLLTPFLPF SSEKVFHLLG GEGTWSAMPE       540
     LREVEDLDGG PGYPVLTGDY EQALARWEST PIEAGRPLAP PTPIFKKLDP SIVDEELARL       600
     GGEAA                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page