(data stored in ACNUC7421 zone)

EMBL: CP001700.PE569

CP001700.PE569       Location/Qualifiers
FT   CDS             672453..673439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0587"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: sma:SAV_3589 deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69524"
FT                   /db_xref="GOA:C7PYW8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW8"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACU69524.1"
FT                   /translation="MADSETGLGGTEPGPADPAASEPGETKRKRKRKSRERDETPPPAP
FT                   EPLPAPVGDSHTHLDMQEPAAADIIAAADAVNVRRLVQVGVDVPSSRTAVELAAAFERV
FT                   HAAVALHPNEAPRLVLGDPDGWSGQHRAPGGAAALEEALAEIDKLAADEQVLGIGETGL
FT                   DYFRTGPEGAQAQQDSFRAHIAIAKRHGKALVIHDRDAHEDVLRILVEEGSPETVVFHC
FT                   YSGDAAMAKVCAERGYYMSFAGNLTYKANQALQEAFQVAPIDRVLVETDAPFLTPLPYR
FT                   GRPNAPYLVPYTVRAMAALRGMDSVTGLAELCQALDSNLRDAFQVRA"
     MADSETGLGG TEPGPADPAA SEPGETKRKR KRKSRERDET PPPAPEPLPA PVGDSHTHLD        60
     MQEPAAADII AAADAVNVRR LVQVGVDVPS SRTAVELAAA FERVHAAVAL HPNEAPRLVL       120
     GDPDGWSGQH RAPGGAAALE EALAEIDKLA ADEQVLGIGE TGLDYFRTGP EGAQAQQDSF       180
     RAHIAIAKRH GKALVIHDRD AHEDVLRILV EEGSPETVVF HCYSGDAAMA KVCAERGYYM       240
     SFAGNLTYKA NQALQEAFQV APIDRVLVET DAPFLTPLPY RGRPNAPYLV PYTVRAMAAL       300
     RGMDSVTGLA ELCQALDSNL RDAFQVRA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page