(data stored in ACNUC7421 zone)

EMBL: CP001700.PE57

CP001700.PE57        Location/Qualifiers
FT   CDS             complement(58453..59514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0057"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV_4365 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69012"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH73"
FT                   /inference="similar to AA sequence:KEGG:SAV_4365"
FT                   /protein_id="ACU69012.1"
FT                   /translation="MDRLSGPGEPFDVIVLAGGGARRLGGTDKPALEIGGVSLLDRVLA
FT                   ACEGAASVAVVGPPRPVARQVVFTREFPPGGGPVPALAAGMTVGSAELVAVFAADMPLL
FT                   DEEAVTVLRRSLTADAVFFTDERGKDQPLAAIYRRNTLAAALDALPELRGARLFSVVEG
FT                   LDATRIPDTRGVTADCDTWEAVHAARALIATRPAAKAKMGDMDDKKLLADWCAAAAAEL
FT                   GLTGHELAESDLDAILGLAGVAAHNVLRPAAPLTTFLAGYAVGLRSSAGGGRGALDGPI
FT                   AKLSALAQAWDPAADGPAGTGHGGAASGTVGGSVAASPTAVRDATTGAAASAKSSSGTS
FT                   GDRAADAAGSGGQ"
     MDRLSGPGEP FDVIVLAGGG ARRLGGTDKP ALEIGGVSLL DRVLAACEGA ASVAVVGPPR        60
     PVARQVVFTR EFPPGGGPVP ALAAGMTVGS AELVAVFAAD MPLLDEEAVT VLRRSLTADA       120
     VFFTDERGKD QPLAAIYRRN TLAAALDALP ELRGARLFSV VEGLDATRIP DTRGVTADCD       180
     TWEAVHAARA LIATRPAAKA KMGDMDDKKL LADWCAAAAA ELGLTGHELA ESDLDAILGL       240
     AGVAAHNVLR PAAPLTTFLA GYAVGLRSSA GGGRGALDGP IAKLSALAQA WDPAADGPAG       300
     TGHGGAASGT VGGSVAASPT AVRDATTGAA ASAKSSSGTS GDRAADAAGS GGQ              353
//

If you have problems or comments...

PBIL Back to PBIL home page