(data stored in ACNUC7421 zone)

EMBL: CP001700.PE570

CP001700.PE570       Location/Qualifiers
FT   CDS             673644..674771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0588"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; protein of
FT                   unknown function DUF348; G5 domain protein; KEGG:
FT                   sma:SAV_3588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69525"
FT                   /db_xref="GOA:C7PYW9"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYW9"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU69525.1"
FT                   /translation="MSSRRSASRHSEGSKVKVRAVQGTVLLGLVGAAGAYVGFEKTVHL
FT                   TVDGQERTIHTFDGKVADVLKAQGISTDGHDQVAPAPGESLADGEQISVRYGRQLDVSV
FT                   DGKDQKIWSTATTVDEALGDLGLHGSNPALSVNRDQAIGRQGLSFQIKTQRHVNVLVDG
FT                   RSIPLDTTAQTVAQALSQAHVTLAGQDTASPAPDTFPTNGETITVDRVTGTQETKQVPI
FT                   AFSTTEQSDPSAYVGSRTTVSSGTQGVQEVVYAYLTVNGVKQAPKIVSKTVTKQPVNAV
FT                   VKVGTKPVPTTVAGADNLNWAGVAQCESGGNPKSVGGGGLYFGLYQFSVSTWAAMGGSG
FT                   LPSNATPAEQTYRAKLLYVRSGAGQWPVCGRKLFT"
     MSSRRSASRH SEGSKVKVRA VQGTVLLGLV GAAGAYVGFE KTVHLTVDGQ ERTIHTFDGK        60
     VADVLKAQGI STDGHDQVAP APGESLADGE QISVRYGRQL DVSVDGKDQK IWSTATTVDE       120
     ALGDLGLHGS NPALSVNRDQ AIGRQGLSFQ IKTQRHVNVL VDGRSIPLDT TAQTVAQALS       180
     QAHVTLAGQD TASPAPDTFP TNGETITVDR VTGTQETKQV PIAFSTTEQS DPSAYVGSRT       240
     TVSSGTQGVQ EVVYAYLTVN GVKQAPKIVS KTVTKQPVNA VVKVGTKPVP TTVAGADNLN       300
     WAGVAQCESG GNPKSVGGGG LYFGLYQFSV STWAAMGGSG LPSNATPAEQ TYRAKLLYVR       360
     SGAGQWPVCG RKLFT                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page