(data stored in ACNUC7421 zone)

EMBL: CP001700.PE571

CP001700.PE571       Location/Qualifiers
FT   CDS             674932..675852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0589"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: sgr:SGR_4356 putative dimethyladenosine
FT                   transferase; TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69526"
FT                   /db_xref="GOA:C7PYX0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX0"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACU69526.1"
FT                   /translation="MSETPHSPPPTPEPDRLPARLLGPAEVRRLAEKLGVSPTKKLGQN
FT                   FVIDPNTIRRIVRAGDVTAEDVVVEVGPGLGSLTLGLLDVARRVVAVEIDPVLAAALPD
FT                   TLAEFAPGIAAGQAEFELVRADALRIAELPGSPPTALVANLPYNVAVPVLLHMLERFPS
FT                   IERTLIMVQSEVADRLAAEPGGRVYGVPSVKARWYADVKRAGAIGRSVFWPAPNVDSGL
FT                   VRLDRRAVPPSTKAGRRDVFAAVDAAFAQRRKTLRSALSGWAGSPAAAETALTAAGINP
FT                   SARGETLTVEEFARLAEHRPQREAA"
     MSETPHSPPP TPEPDRLPAR LLGPAEVRRL AEKLGVSPTK KLGQNFVIDP NTIRRIVRAG        60
     DVTAEDVVVE VGPGLGSLTL GLLDVARRVV AVEIDPVLAA ALPDTLAEFA PGIAAGQAEF       120
     ELVRADALRI AELPGSPPTA LVANLPYNVA VPVLLHMLER FPSIERTLIM VQSEVADRLA       180
     AEPGGRVYGV PSVKARWYAD VKRAGAIGRS VFWPAPNVDS GLVRLDRRAV PPSTKAGRRD       240
     VFAAVDAAFA QRRKTLRSAL SGWAGSPAAA ETALTAAGIN PSARGETLTV EEFARLAEHR       300
     PQREAA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page