(data stored in ACNUC7421 zone)

EMBL: CP001700.PE572

CP001700.PE572       Location/Qualifiers
FT   CDS             675849..676799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0590"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: mjl:Mjls_4641 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69527"
FT                   /db_xref="GOA:C7PYX1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX1"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACU69527.1"
FT                   /translation="MSSAAYIPDEGPRPGETESVTVRVPAKVNLALSVGPLRSDGYHDL
FT                   ATVFHAVGLFDEVNAAAADTLAVTCEGEGQVEVPLDDTNLAWRAAELLARTVGRSPGVR
FT                   LHLTKGIPVAGGMAGGSADAAGALVACDALWGTGLSRDDLHVLAAQLGSDVPFALHGGT
FT                   AMGTGRGEQITPVLARGEFHWVFAFAHDGLSTPAVFHELDRLREAAGEEATAPGVEDEL
FT                   LRALRAGDSTLLGAALRNDLTRPATSLRPDLRATLQAGREAGALGTLLSGSGPTCAFLA
FT                   ADAVAAATVAAALEAAPSVRAVRRALGPAAGAHLL"
     MSSAAYIPDE GPRPGETESV TVRVPAKVNL ALSVGPLRSD GYHDLATVFH AVGLFDEVNA        60
     AAADTLAVTC EGEGQVEVPL DDTNLAWRAA ELLARTVGRS PGVRLHLTKG IPVAGGMAGG       120
     SADAAGALVA CDALWGTGLS RDDLHVLAAQ LGSDVPFALH GGTAMGTGRG EQITPVLARG       180
     EFHWVFAFAH DGLSTPAVFH ELDRLREAAG EEATAPGVED ELLRALRAGD STLLGAALRN       240
     DLTRPATSLR PDLRATLQAG REAGALGTLL SGSGPTCAFL AADAVAAATV AAALEAAPSV       300
     RAVRRALGPA AGAHLL                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page