(data stored in ACNUC7421 zone)

EMBL: CP001700.PE573

CP001700.PE573       Location/Qualifiers
FT   CDS             676873..679386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0591"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: fal:FRAAL0578 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69528"
FT                   /db_xref="GOA:C7PYX2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7PYX2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69528.1"
FT                   /translation="MDALKPEDPSRVGPFTPLARIGAGGMGRVYLARSRGGRPVAVKVI
FT                   RAEYAEDERFRTRFRREVQAARTVDGMYTAPVLDAGPDDAEPWLATAYIPGPSLQRAVH
FT                   EHGPLPERTARVMGAGIAEALGAIHSAGLIHRDLKPSNVILGPDGPRVIDFGISASEGG
FT                   SSLTTTGIVVGSPRYSSPEQCRADPALGPASDVFALGGVMVYATTGVPPFGDGPDHVQL
FT                   YLVVHETPDLTGVPMGLRPIVSACLEKDPANRPTTDELLDTLLPPEEAGATNAVDWLPD
FT                   AVYRDLREYSAAPIVALAAGTTHERGEDSARTPAPGEATPTGAGFDGGGVTGIGSGVGT
FT                   TAAPSSAGSDGPSNPGRRRMLAGIAGAVVVAAGGGGAWYAATRDSGRKSATQSAGATFP
FT                   PSTGSQNPSTPAAPSTTPTPSTTPSTTPTPTPSHVLGPWQEDWSSKTDLGGASGGAVIS
FT                   GSKLVGVYTATSVSNPIPPQDLIAIDTVSGGSAFPARSIPAVDNVGGAGIAADDTHAYS
FT                   YGAGTVYAWNLSDGSAAWNAKSGLQTSTSTNNMPTTGILGMVGTLLMVGSGNYDPGFPP
FT                   CLAAFDVTLKKAVWTLKPEDMQIVASPPTGLVLNQTSIAVSIPKLGNLFYVMLCDENSL
FT                   RVLKAMDMATGKEVWHVFFEAYSDNGAGTVTPTVTGTEQHVYLTDMHSGSVHAYSAAGK
FT                   WMWTYPSAVGKTAPSSDRRFTGQVLESGDAVYAADANRVYALQVSTKAVGGTPVWKNPA
FT                   TFNGIANVPALVGDKIWVEVHTPTEKNPLAMIVVDTADGQVVHSYPMPEGPTASSAELT
FT                   VPDPSGQAAYVLTASGQVLGYRRNQ"
     MDALKPEDPS RVGPFTPLAR IGAGGMGRVY LARSRGGRPV AVKVIRAEYA EDERFRTRFR        60
     REVQAARTVD GMYTAPVLDA GPDDAEPWLA TAYIPGPSLQ RAVHEHGPLP ERTARVMGAG       120
     IAEALGAIHS AGLIHRDLKP SNVILGPDGP RVIDFGISAS EGGSSLTTTG IVVGSPRYSS       180
     PEQCRADPAL GPASDVFALG GVMVYATTGV PPFGDGPDHV QLYLVVHETP DLTGVPMGLR       240
     PIVSACLEKD PANRPTTDEL LDTLLPPEEA GATNAVDWLP DAVYRDLREY SAAPIVALAA       300
     GTTHERGEDS ARTPAPGEAT PTGAGFDGGG VTGIGSGVGT TAAPSSAGSD GPSNPGRRRM       360
     LAGIAGAVVV AAGGGGAWYA ATRDSGRKSA TQSAGATFPP STGSQNPSTP AAPSTTPTPS       420
     TTPSTTPTPT PSHVLGPWQE DWSSKTDLGG ASGGAVISGS KLVGVYTATS VSNPIPPQDL       480
     IAIDTVSGGS AFPARSIPAV DNVGGAGIAA DDTHAYSYGA GTVYAWNLSD GSAAWNAKSG       540
     LQTSTSTNNM PTTGILGMVG TLLMVGSGNY DPGFPPCLAA FDVTLKKAVW TLKPEDMQIV       600
     ASPPTGLVLN QTSIAVSIPK LGNLFYVMLC DENSLRVLKA MDMATGKEVW HVFFEAYSDN       660
     GAGTVTPTVT GTEQHVYLTD MHSGSVHAYS AAGKWMWTYP SAVGKTAPSS DRRFTGQVLE       720
     SGDAVYAADA NRVYALQVST KAVGGTPVWK NPATFNGIAN VPALVGDKIW VEVHTPTEKN       780
     PLAMIVVDTA DGQVVHSYPM PEGPTASSAE LTVPDPSGQA AYVLTASGQV LGYRRNQ          837
//

If you have problems or comments...

PBIL Back to PBIL home page