(data stored in ACNUC7421 zone)

EMBL: CP001700.PE58

CP001700.PE58        Location/Qualifiers
FT   CDS             59678..60886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0058"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sgr:SGR_6775 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69013"
FT                   /db_xref="GOA:C7QH74"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH74"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69013.1"
FT                   /translation="MQPPEHLAYTPAQRALRAELRTYFAALVTEEVHRDLRLPDTATDT
FT                   ARTLHRKLGADGWLGVGWPQEYGGRGLTPVEQFIFFDEAARAGCPMPLVALNTVGPTLM
FT                   RFGTQEQKDLLLPGILAGEIDVAAGYSEPGAGTDLASLTTRAVLTEDGSAYAVNGQKIF
FT                   TTHGDSAEYVWLACRTDPDAPKHKGISILLVDTKDPGFEATKIHTIASHYTTATYYRDV
FT                   RVPVTMRVGAENAGWKLITTQLNHERVALAAVAQGVIRSFAKVQSWAMETPAADGKRVI
FT                   DLPWVKTTMARAYIRISGLRLLNGQMVAALQKDQTGGHLSPADASAAKVHGTETHIEAL
FT                   AELIQVLGAGGILKTGSPGALLAGDLEYLYRWAVTNTFGGGANEIQREIIAMTGLAMPR
FT                   VRR"
     MQPPEHLAYT PAQRALRAEL RTYFAALVTE EVHRDLRLPD TATDTARTLH RKLGADGWLG        60
     VGWPQEYGGR GLTPVEQFIF FDEAARAGCP MPLVALNTVG PTLMRFGTQE QKDLLLPGIL       120
     AGEIDVAAGY SEPGAGTDLA SLTTRAVLTE DGSAYAVNGQ KIFTTHGDSA EYVWLACRTD       180
     PDAPKHKGIS ILLVDTKDPG FEATKIHTIA SHYTTATYYR DVRVPVTMRV GAENAGWKLI       240
     TTQLNHERVA LAAVAQGVIR SFAKVQSWAM ETPAADGKRV IDLPWVKTTM ARAYIRISGL       300
     RLLNGQMVAA LQKDQTGGHL SPADASAAKV HGTETHIEAL AELIQVLGAG GILKTGSPGA       360
     LLAGDLEYLY RWAVTNTFGG GANEIQREII AMTGLAMPRV RR                          402
//

If you have problems or comments...

PBIL Back to PBIL home page