(data stored in ACNUC7421 zone)

EMBL: CP001700.PE59

CP001700.PE59        Location/Qualifiers
FT   CDS             60895..61416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69014"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH75"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_5992"
FT                   /protein_id="ACU69014.1"
FT                   /translation="METDPLYETVSAHIADPPSEPVPAWDPVNQPMIRHWCDAMGDDLP
FT                   IYTDAAAARAAGHPDVVAPPASLQAWTMPGLRMRGFEDGTTRAQAMLVEAGYRAVVATD
FT                   CEQTYHRYLTIGDHLYATSRLDSVSPRKKTALGEGYFLTSVTEYRDQRGELLGEMLFRT
FT                   LWFKPKEPAA"
     METDPLYETV SAHIADPPSE PVPAWDPVNQ PMIRHWCDAM GDDLPIYTDA AAARAAGHPD        60
     VVAPPASLQA WTMPGLRMRG FEDGTTRAQA MLVEAGYRAV VATDCEQTYH RYLTIGDHLY       120
     ATSRLDSVSP RKKTALGEGY FLTSVTEYRD QRGELLGEML FRTLWFKPKE PAA              173
//

If you have problems or comments...

PBIL Back to PBIL home page