(data stored in ACNUC7421 zone)

EMBL: CP001700.PE6

CP001700.PE6         Location/Qualifiers
FT   CDS             7225..9210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4321 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68961"
FT                   /db_xref="GOA:C7QFM2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU68961.1"
FT                   /translation="MADVEPTGGSTPSLDGIYNADSISVLEGLEAVRKRPGMYIGSTGE
FT                   RGLHHLVYEIVDNSVDEAMAGYADTIEVWLLADGGVKVVDNGRGIPVGINTKTGKSALE
FT                   VVMTILHAGGKFGDGGYKVSGGLHGVGVSVVNALSSRVEVEVHTDGFVWNQVYKHGVPE
FT                   TEVQKGGPAADTGTSTIFWADVDIFETTVYSFETLSRRFQEMAFLNKGLTISLTDERPE
FT                   FRDENGEQRSVKYHAEGGIADFVRHINSRKGEPVHPNVIDFEGEDKDRTLAAEIALQWN
FT                   SQYSESIYTFANNINTHGGGTHEEGFRAALTTLINKYARDQKLLKEKDDNLAGEDIREG
FT                   LTTIVSVKLAEPQFEGQTKDKLGNPEAKTFVQRLVYEKLGEWLEENPNEAREVIRKTIQ
FT                   ASTARMAARKARELTRRKGLLESSSLPGKLSDCQSNDPTKTEIFIVEGDSAGGSARSGR
FT                   DPMTQAILPIRGKILNVEKARIDKVLQNTEVQALISALGTGVHDDFDISRLRYHKIILM
FT                   ADADVDGAHINTLLLTLLFRFMKPLVEAGHVYLAAPPLYKVKWTNNDFNYAYSDRERDQ
FT                   LLEAGVGAGKRRKDETVQRFKGLGEMNAEELRITTMDREHRILRQVTLDDAAQADDLFS
FT                   VLMGEDVEARRNFIQRNAKDVRFLDI"
     MADVEPTGGS TPSLDGIYNA DSISVLEGLE AVRKRPGMYI GSTGERGLHH LVYEIVDNSV        60
     DEAMAGYADT IEVWLLADGG VKVVDNGRGI PVGINTKTGK SALEVVMTIL HAGGKFGDGG       120
     YKVSGGLHGV GVSVVNALSS RVEVEVHTDG FVWNQVYKHG VPETEVQKGG PAADTGTSTI       180
     FWADVDIFET TVYSFETLSR RFQEMAFLNK GLTISLTDER PEFRDENGEQ RSVKYHAEGG       240
     IADFVRHINS RKGEPVHPNV IDFEGEDKDR TLAAEIALQW NSQYSESIYT FANNINTHGG       300
     GTHEEGFRAA LTTLINKYAR DQKLLKEKDD NLAGEDIREG LTTIVSVKLA EPQFEGQTKD       360
     KLGNPEAKTF VQRLVYEKLG EWLEENPNEA REVIRKTIQA STARMAARKA RELTRRKGLL       420
     ESSSLPGKLS DCQSNDPTKT EIFIVEGDSA GGSARSGRDP MTQAILPIRG KILNVEKARI       480
     DKVLQNTEVQ ALISALGTGV HDDFDISRLR YHKIILMADA DVDGAHINTL LLTLLFRFMK       540
     PLVEAGHVYL AAPPLYKVKW TNNDFNYAYS DRERDQLLEA GVGAGKRRKD ETVQRFKGLG       600
     EMNAEELRIT TMDREHRILR QVTLDDAAQA DDLFSVLMGE DVEARRNFIQ RNAKDVRFLD       660
     I                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page