(data stored in ACNUC7421 zone)

EMBL: CP001700.PE60

CP001700.PE60        Location/Qualifiers
FT   CDS             61413..61823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0060"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mpa:MAP2587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69015"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH76"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACU69015.1"
FT                   /translation="MTRPLPVTGRDNAYYWEGVAKGDVLIQKCTACGSLRHPPSPMCPD
FT                   CQSLDWTTVKATGHAVLHSYTICHHPLPPWEEGPYAVVLIDLDMEDSDARPRIVCGTRG
FT                   IANEDLRIEMPLSLVFEDGLVFAGPAQEGGAP"
     MTRPLPVTGR DNAYYWEGVA KGDVLIQKCT ACGSLRHPPS PMCPDCQSLD WTTVKATGHA        60
     VLHSYTICHH PLPPWEEGPY AVVLIDLDME DSDARPRIVC GTRGIANEDL RIEMPLSLVF       120
     EDGLVFAGPA QEGGAP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page