(data stored in ACNUC7421 zone)

EMBL: CP001700.PE61

CP001700.PE61        Location/Qualifiers
FT   CDS             61829..62908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0061"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: sgr:SGR_3736
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69016"
FT                   /db_xref="GOA:C7QH77"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH77"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69016.1"
FT                   /translation="MDQPVDDALEAIGELSSEVFKDLDIETTRSPAYSNEAVSDEHDRR
FT                   LWRILADTGLLAAVLPASVGGGGTGLPGMVRLLSDAGAALARLPLVETFVAVSVIDEKH
FT                   LPAVLSGELVITAALAEHPSTITAPLRLTGQRLNGITQLVPYPLSSDLVLVPALREDDT
FT                   EVLALVSLSTARVGDQVTTTGEPLGVLEFIDAEVMELCDAVGEARALAALFSSATLCGI
FT                   AARALAMTAEYVGGRVQFGHPLATFQGVALSAADRYIDSRAMQAALWDAVYAIAENGIS
FT                   SPRARYAIATARVWAADGARRVVGSAQHLHGGFGVDVTYPLHRYHAWARYWELYGGSAE
FT                   AWSGDLGELIAAHPIEEDQ"
     MDQPVDDALE AIGELSSEVF KDLDIETTRS PAYSNEAVSD EHDRRLWRIL ADTGLLAAVL        60
     PASVGGGGTG LPGMVRLLSD AGAALARLPL VETFVAVSVI DEKHLPAVLS GELVITAALA       120
     EHPSTITAPL RLTGQRLNGI TQLVPYPLSS DLVLVPALRE DDTEVLALVS LSTARVGDQV       180
     TTTGEPLGVL EFIDAEVMEL CDAVGEARAL AALFSSATLC GIAARALAMT AEYVGGRVQF       240
     GHPLATFQGV ALSAADRYID SRAMQAALWD AVYAIAENGI SSPRARYAIA TARVWAADGA       300
     RRVVGSAQHL HGGFGVDVTY PLHRYHAWAR YWELYGGSAE AWSGDLGELI AAHPIEEDQ        359
//

If you have problems or comments...

PBIL Back to PBIL home page