(data stored in ACNUC7421 zone)

EMBL: CP001700.PE62

CP001700.PE62        Location/Qualifiers
FT   CDS             62905..63306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0062"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rha:RHA1_ro05828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69017"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH78"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACU69017.1"
FT                   /translation="MSALPKVGEALPELIIPITPTRIVSGAIASRDYQDVHHDVPAARE
FT                   KGSPDIFMNILTTNGLVGRYVTDWAGAEARILKIAIRLGVPNYPGDTMTLTGSVASVGE
FT                   DGAVEVAIRGANQLGNHVTGTVTLKGLGE"
     MSALPKVGEA LPELIIPITP TRIVSGAIAS RDYQDVHHDV PAAREKGSPD IFMNILTTNG        60
     LVGRYVTDWA GAEARILKIA IRLGVPNYPG DTMTLTGSVA SVGEDGAVEV AIRGANQLGN       120
     HVTGTVTLKG LGE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page