(data stored in ACNUC7421 zone)

EMBL: CP001700.PE63

CP001700.PE63        Location/Qualifiers
FT   CDS             63309..64481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0063"
FT                   /product="lipid-transfer protein"
FT                   /note="KEGG: nfa:nfa4530 lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69018"
FT                   /db_xref="GOA:C7QH79"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH79"
FT                   /inference="similar to AA sequence:KEGG:nfa4530"
FT                   /protein_id="ACU69018.1"
FT                   /translation="MSLAGEAAIVGIGATEFSKESGRSELQLCLEACKAALDDAGIAPR
FT                   DVDGLVTFSMDSSPSIMVGRGLGVAELRHFSLVDYGGGAACATVAHAAAAITAGLADVV
FT                   VCYRAFNERSGRRFGSGDAAIQARGESPMAQHFGYYSPYGLITPAAWVAMAARRYMHKY
FT                   GATSEDFGRVAVAARTHAATNPAAWFYERPITLADHQSSKLIADPVRLLDCCQESDGGV
FT                   ALVVVSAERARDLPGKEVLIAGAAQGSAHDQQMMTSYYREDISGLPEMGTVARQLWNQS
FT                   GLGPDDIQTAVIYDHFTPFVLTQLEEFGFCGRGEARDFIRDGAIHIGGRLPLNTHGGQL
FT                   GEAYIHGMNGIAEAVRQARGTAVNQVPDVHNVLVTAGTGVPTSGLVLSAV"
     MSLAGEAAIV GIGATEFSKE SGRSELQLCL EACKAALDDA GIAPRDVDGL VTFSMDSSPS        60
     IMVGRGLGVA ELRHFSLVDY GGGAACATVA HAAAAITAGL ADVVVCYRAF NERSGRRFGS       120
     GDAAIQARGE SPMAQHFGYY SPYGLITPAA WVAMAARRYM HKYGATSEDF GRVAVAARTH       180
     AATNPAAWFY ERPITLADHQ SSKLIADPVR LLDCCQESDG GVALVVVSAE RARDLPGKEV       240
     LIAGAAQGSA HDQQMMTSYY REDISGLPEM GTVARQLWNQ SGLGPDDIQT AVIYDHFTPF       300
     VLTQLEEFGF CGRGEARDFI RDGAIHIGGR LPLNTHGGQL GEAYIHGMNG IAEAVRQARG       360
     TAVNQVPDVH NVLVTAGTGV PTSGLVLSAV                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page